Recombinant Human HNRNPD protein, GST-His-tagged

• Cat.No.: HNRNPD-4633H
• Product Overview: Recombinant Human HNRNPD protein(Q14103)(2-355 aa), fused with N-terminal GST tag and C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 2-355 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 65.3 kDa
• AASequence: SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: HNRNPD heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) [ Homo sapiens ]
• Official Symbol: HNRNPD
• Synonyms: HNRNPD; heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa); AUF1, heterogeneous nuclear ribonucleoprotein D (AU rich element RNA binding protein 1, 37kD) , HNRPD; heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; ARE-binding protein AUFI, type A; P37; AUF1; AUF1A; HNRPD; hnRNPD0
• Gene ID: 3184
• mRNA Refseq: NM_001003810
• Protein Refseq: NP_001003810
• MIM: 601324
• UniProt ID: Q14103