Recombinant Human HNRNPD protein, GST-His-tagged
| Cat.No. : | HNRNPD-4633H |
| Product Overview : | Recombinant Human HNRNPD protein(Q14103)(2-355 aa), fused with N-terminal GST tag and C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 2-355 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 65.3 kDa |
| AASequence : | SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | HNRNPD heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) [ Homo sapiens ] |
| Official Symbol | HNRNPD |
| Synonyms | HNRNPD; heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa); AUF1, heterogeneous nuclear ribonucleoprotein D (AU rich element RNA binding protein 1, 37kD) , HNRPD; heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; ARE-binding protein AUFI, type A; P37; AUF1; AUF1A; HNRPD; hnRNPD0; |
| Gene ID | 3184 |
| mRNA Refseq | NM_001003810 |
| Protein Refseq | NP_001003810 |
| MIM | 601324 |
| UniProt ID | Q14103 |
| ◆ Recombinant Proteins | ||
| Hnrnpd-681M | Recombinant Mouse Hnrnpd Protein, MYC/DDK-tagged | +Inquiry |
| HNRNPD-6181Z | Recombinant Zebrafish HNRNPD | +Inquiry |
| HNRNPD-004H | Recombinant Human HNRNPD Protein, His-tagged | +Inquiry |
| HNRNPD-002H | Recombinant Human HNRNPD Protein, Myc/DDK-tagged | +Inquiry |
| HNRNPD-2638H | Recombinant Human HNRNPD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPD-5448HCL | Recombinant Human HNRNPD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPD Products
Required fields are marked with *
My Review for All HNRNPD Products
Required fields are marked with *
