Recombinant Human HNRNPD protein, GST-His-tagged

Cat.No. : HNRNPD-4633H
Product Overview : Recombinant Human HNRNPD protein(Q14103)(2-355 aa), fused with N-terminal GST tag and C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 2-355 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 65.3 kDa
AASequence : SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name HNRNPD heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) [ Homo sapiens ]
Official Symbol HNRNPD
Synonyms HNRNPD; heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa); AUF1, heterogeneous nuclear ribonucleoprotein D (AU rich element RNA binding protein 1, 37kD) , HNRPD; heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; ARE-binding protein AUFI, type A; P37; AUF1; AUF1A; HNRPD; hnRNPD0;
Gene ID 3184
mRNA Refseq NM_001003810
Protein Refseq NP_001003810
MIM 601324
UniProt ID Q14103

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPD Products

Required fields are marked with *

My Review for All HNRNPD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon