Recombinant Human HNRPLL protein, His-tagged
Cat.No. : | HNRPLL-2894H |
Product Overview : | Recombinant Human HNRPLL protein(1-70 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-70 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HNRPLL heterogeneous nuclear ribonucleoprotein L-like [ Homo sapiens ] |
Official Symbol | HNRPLL |
Synonyms | HNRPLL; heterogeneous nuclear ribonucleoprotein L-like; stromal RNA regulating factor; stromal RNA-regulating factor; SRRF; hnRNPLL; |
Gene ID | 92906 |
mRNA Refseq | NM_001142650 |
Protein Refseq | NP_001136122 |
MIM | 611208 |
UniProt ID | Q8WVV9 |
◆ Recombinant Proteins | ||
HNRPLL-4919H | Recombinant Human HNRPLL Protein, GST-tagged | +Inquiry |
HNRPLL-2894H | Recombinant Human HNRPLL protein, His-tagged | +Inquiry |
HNRPLL-6843H | Recombinant Human HNRPLL protein, GST-tagged | +Inquiry |
HNRPLL-7773M | Recombinant Mouse HNRPLL Protein | +Inquiry |
HNRPLL-3685HF | Recombinant Full Length Human HNRPLL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRPLL-5438HCL | Recombinant Human HNRPLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRPLL Products
Required fields are marked with *
My Review for All HNRPLL Products
Required fields are marked with *