Recombinant Human HOPX Protein, GST-tagged

Cat.No. : HOPX-4934H
Product Overview : Human HOP full-length ORF ( AAH14225, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq
Molecular Mass : 33.77 kDa
AA Sequence : MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOPX HOP homeobox [ Homo sapiens ]
Official Symbol HOPX
Synonyms HOPX; HOP homeobox; homeodomain-only protein; homeobox only domain; HOP; LAGY; NECC1; OB1; SMAP31; odd homeobox 1 protein; odd homeobox protein 1; lung cancer-associated Y protein; not expressed in choriocarcinoma clone 1; not expressed in choriocarcinoma protein 1; HOD; TOTO; CAMEO; MGC20820;
Gene ID 84525
mRNA Refseq NM_001145459
Protein Refseq NP_001138931
MIM 607275
UniProt ID Q9BPY8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOPX Products

Required fields are marked with *

My Review for All HOPX Products

Required fields are marked with *

0
cart-icon
0
compare icon