Recombinant Human HOPX Protein, GST-tagged
| Cat.No. : | HOPX-4934H |
| Product Overview : | Human HOP full-length ORF ( AAH14225, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq |
| Molecular Mass : | 33.77 kDa |
| AA Sequence : | MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HOPX HOP homeobox [ Homo sapiens ] |
| Official Symbol | HOPX |
| Synonyms | HOPX; HOP homeobox; homeodomain-only protein; homeobox only domain; HOP; LAGY; NECC1; OB1; SMAP31; odd homeobox 1 protein; odd homeobox protein 1; lung cancer-associated Y protein; not expressed in choriocarcinoma clone 1; not expressed in choriocarcinoma protein 1; HOD; TOTO; CAMEO; MGC20820; |
| Gene ID | 84525 |
| mRNA Refseq | NM_001145459 |
| Protein Refseq | NP_001138931 |
| MIM | 607275 |
| UniProt ID | Q9BPY8 |
| ◆ Recombinant Proteins | ||
| HOPX-4273M | Recombinant Mouse HOPX Protein, His (Fc)-Avi-tagged | +Inquiry |
| HOPX-3488H | Recombinant Human HOPX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HOPX-3700HF | Recombinant Full Length Human HOPX Protein, GST-tagged | +Inquiry |
| HOPX-6951H | Recombinant Human HOP Homeobox, His-tagged | +Inquiry |
| Hopx-3431M | Recombinant Mouse Hopx Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOPX-5432HCL | Recombinant Human HOPX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOPX Products
Required fields are marked with *
My Review for All HOPX Products
Required fields are marked with *
