Recombinant Human HOXA3 Protein, GST-tagged

Cat.No. : HOXA3-4944H
Product Overview : Human HOXA3 partial ORF ( NP_705895, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 34.21 kDa
AA Sequence : MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXA3 homeobox A3 [ Homo sapiens ]
Official Symbol HOXA3
Synonyms HOXA3; homeobox A3; homeo box A3 , HOX1, HOX1E; homeobox protein Hox-A3; homeo box 1E; homeo box A3; Hox-1.5-like protein; homeobox protein Hox-1E; HOX1; HOX1E; MGC10155;
Gene ID 3200
mRNA Refseq NM_030661
Protein Refseq NP_109377
MIM 142954
UniProt ID O43365

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA3 Products

Required fields are marked with *

My Review for All HOXA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon