Recombinant Human HOXA3 Protein, GST-tagged
Cat.No. : | HOXA3-4944H |
Product Overview : | Human HOXA3 partial ORF ( NP_705895, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 34.21 kDa |
AA Sequence : | MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA3 homeobox A3 [ Homo sapiens ] |
Official Symbol | HOXA3 |
Synonyms | HOXA3; homeobox A3; homeo box A3 , HOX1, HOX1E; homeobox protein Hox-A3; homeo box 1E; homeo box A3; Hox-1.5-like protein; homeobox protein Hox-1E; HOX1; HOX1E; MGC10155; |
Gene ID | 3200 |
mRNA Refseq | NM_030661 |
Protein Refseq | NP_109377 |
MIM | 142954 |
UniProt ID | O43365 |
◆ Recombinant Proteins | ||
HOXA3-6117C | Recombinant Chicken HOXA3 | +Inquiry |
HOXA3-6435H | Recombinant Human HOXA3 protein, His-tagged | +Inquiry |
HOXA3-3627H | Recombinant Human HOXA3 Protein (Met1-Leu443), N-GST tagged | +Inquiry |
HOXA3-4279M | Recombinant Mouse HOXA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA3-4944H | Recombinant Human HOXA3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA3-5426HCL | Recombinant Human HOXA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA3 Products
Required fields are marked with *
My Review for All HOXA3 Products
Required fields are marked with *