Recombinant Human HOXA4 Protein, GST-tagged
| Cat.No. : | HOXA4-4945H |
| Product Overview : | Human HOXA4 partial ORF ( NP_002132, 181 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HOXA4 homeobox A4 [ Homo sapiens ] |
| Official Symbol | HOXA4 |
| Synonyms | HOXA4; homeobox A4; homeo box A4 , HOX1, HOX1D; homeobox protein Hox-A4; homeo box A4; Dfd-like protein; Hox-1.4-like protein; homeobox protein Hox-1D; homeobox protein Hox-1.4; HOX1; HOX1D; |
| Gene ID | 3201 |
| mRNA Refseq | NM_002141 |
| Protein Refseq | NP_002132 |
| MIM | 142953 |
| UniProt ID | Q00056 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA4 Products
Required fields are marked with *
My Review for All HOXA4 Products
Required fields are marked with *



