Recombinant Human HOXA4 Protein, GST-tagged
Cat.No. : | HOXA4-4945H |
Product Overview : | Human HOXA4 partial ORF ( NP_002132, 181 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq |
Molecular Mass : | 35.64 kDa |
AA Sequence : | DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA4 homeobox A4 [ Homo sapiens ] |
Official Symbol | HOXA4 |
Synonyms | HOXA4; homeobox A4; homeo box A4 , HOX1, HOX1D; homeobox protein Hox-A4; homeo box A4; Dfd-like protein; Hox-1.4-like protein; homeobox protein Hox-1D; homeobox protein Hox-1.4; HOX1; HOX1D; |
Gene ID | 3201 |
mRNA Refseq | NM_002141 |
Protein Refseq | NP_002132 |
MIM | 142953 |
UniProt ID | Q00056 |
◆ Recombinant Proteins | ||
HOXA4-4280M | Recombinant Mouse HOXA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA4-7790M | Recombinant Mouse HOXA4 Protein | +Inquiry |
HOXA4-4945H | Recombinant Human HOXA4 Protein, GST-tagged | +Inquiry |
HOXA4-2231C | Recombinant Chicken HOXA4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA4 Products
Required fields are marked with *
My Review for All HOXA4 Products
Required fields are marked with *
0
Inquiry Basket