Recombinant Human HOXA4 Protein, GST-tagged

Cat.No. : HOXA4-4945H
Product Overview : Human HOXA4 partial ORF ( NP_002132, 181 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq
Molecular Mass : 35.64 kDa
AA Sequence : DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXA4 homeobox A4 [ Homo sapiens ]
Official Symbol HOXA4
Synonyms HOXA4; homeobox A4; homeo box A4 , HOX1, HOX1D; homeobox protein Hox-A4; homeo box A4; Dfd-like protein; Hox-1.4-like protein; homeobox protein Hox-1D; homeobox protein Hox-1.4; HOX1; HOX1D;
Gene ID 3201
mRNA Refseq NM_002141
Protein Refseq NP_002132
MIM 142953
UniProt ID Q00056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA4 Products

Required fields are marked with *

My Review for All HOXA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon