Recombinant Human HOXA5 protein, GST-tagged
Cat.No. : | HOXA5-301240H |
Product Overview : | Recombinant Human HOXA5 (64-163 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser64-Gln163 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | FGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HOXA5 homeobox A5 [ Homo sapiens ] |
Official Symbol | HOXA5 |
Synonyms | HOXA5; homeobox A5; homeo box A5 , HOX1, HOX1C; homeobox protein Hox-A5; homeo box 1C; homeo box A5; homeobox protein HOXA5; homeobox protein Hox-1C; HOX1; HOX1C; HOX1.3; MGC9376; |
Gene ID | 3202 |
mRNA Refseq | NM_019102 |
Protein Refseq | NP_061975 |
MIM | 142952 |
UniProt ID | P20719 |
◆ Recombinant Proteins | ||
HOXA5-7791M | Recombinant Mouse HOXA5 Protein | +Inquiry |
HOXA5-067H | Recombinant Human HOXA5 Protein, GST-HIS-tagged | +Inquiry |
HOXA5-4281M | Recombinant Mouse HOXA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA5-4946H | Recombinant Human HOXA5 Protein, GST-tagged | +Inquiry |
HOXA5-2777H | Recombinant Human HOXA5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA5-5425HCL | Recombinant Human HOXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA5 Products
Required fields are marked with *
My Review for All HOXA5 Products
Required fields are marked with *
0
Inquiry Basket