Recombinant Human HOXA6 Protein, GST-tagged

Cat.No. : HOXA6-4948H
Product Overview : Human HOXA6 full-length ORF ( NP_076919.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq
Molecular Mass : 52.7 kDa
AA Sequence : MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXA6 homeobox A6 [ Homo sapiens ]
Official Symbol HOXA6
Synonyms HOXA6; homeobox A6; homeo box A6 , HOX1, HOX1B; homeobox protein Hox-A6; homeo box 1B; homeo box A6; homeobox protein HOXA6; homeobox protein Hox-1B; HOX1; HOX1B; HOX1.2;
Gene ID 3203
mRNA Refseq NM_024014
Protein Refseq NP_076919
MIM 142951
UniProt ID P31267

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA6 Products

Required fields are marked with *

My Review for All HOXA6 Products

Required fields are marked with *

0
cart-icon
0
compare icon