Recombinant Human HOXB2 protein, His-tagged
Cat.No. : | HOXB2-2771H |
Product Overview : | Recombinant Human HOXB2 protein(224-312 aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 224-312 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PAEEPAASPGGPSASRAAWEACCHPPEVVPGALSADPRPLAVRLEGAGASSPGCALRGAGGLEPGPLPEDVFSGRQDSPFLPDLNFFAA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HOXB2 homeobox B2 [ Homo sapiens ] |
Official Symbol | HOXB2 |
Synonyms | HOXB2; homeobox B2; homeo box B2 , HOX2, HOX2H; homeobox protein Hox-B2; homeo box 2H; homeo box B2; K8 home protein; homeobox protein Hox-2H; homeobox protein Hox-2.8; K8; HOX2; HOX2H; Hox-2.8; |
Gene ID | 3212 |
mRNA Refseq | NM_002145 |
Protein Refseq | NP_002136 |
MIM | 142967 |
UniProt ID | P14652 |
◆ Recombinant Proteins | ||
HOXB2-3716HF | Recombinant Full Length Human HOXB2 Protein, GST-tagged | +Inquiry |
HOXB2-4958H | Recombinant Human HOXB2 Protein, GST-tagged | +Inquiry |
HOXB2-4285M | Recombinant Mouse HOXB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXB2-7797M | Recombinant Mouse HOXB2 Protein | +Inquiry |
HOXB2-2771H | Recombinant Human HOXB2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXB2 Products
Required fields are marked with *
My Review for All HOXB2 Products
Required fields are marked with *