Recombinant Human HOXC13 Protein, GST-tagged
| Cat.No. : | HOXC13-4977H |
| Product Overview : | Human HOXC13 full-length ORF (NP_059106.2, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the development of hair, nail, and filiform papilla. [provided by RefSeq |
| Molecular Mass : | 62.7 kDa |
| AA Sequence : | MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HOXC13 homeobox C13 [ Homo sapiens ] |
| Official Symbol | HOXC13 |
| Synonyms | HOXC13; homeobox C13; homeo box C13 , HOX3, HOX3G; homeobox protein Hox-C13; NUP98/HOXC13; homeo box 3G; homeo box C13; homeobox protein Hox-3G; HOX3; HOX3G; |
| Gene ID | 3229 |
| mRNA Refseq | NM_017410 |
| Protein Refseq | NP_059106 |
| MIM | 142976 |
| UniProt ID | P31276 |
| ◆ Recombinant Proteins | ||
| HOXC13-4291M | Recombinant Mouse HOXC13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HOXC13-4977H | Recombinant Human HOXC13 Protein, GST-tagged | +Inquiry |
| HOXC13-7807M | Recombinant Mouse HOXC13 Protein | +Inquiry |
| HOXC13-3725HF | Recombinant Full Length Human HOXC13 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC13 Products
Required fields are marked with *
My Review for All HOXC13 Products
Required fields are marked with *




