| Description : |
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons. |
| Protein length : |
105 amino acids |
| Molecular Weight : |
37.180kDa inclusive of tags |
| Source : |
Wheat germ |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQ IKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAAT PGTSEDHSQSATPPEQQRAEDITRL |
| Sequence Similarities : |
Belongs to the Antp homeobox family. Deformed subfamily.Contains 1 homeobox DNA-binding domain. |
