Recombinant Human HOXC4
Cat.No. : | HOXC4-28513TH |
Product Overview : | Recombinant fragment of Human HOXC4 with N terminal proprietary tag; Predicted MW 37.18 kDa;. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons. |
Protein length : | 105 amino acids |
Molecular Weight : | 37.180kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQ IKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAAT PGTSEDHSQSATPPEQQRAEDITRL |
Sequence Similarities : | Belongs to the Antp homeobox family. Deformed subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name : | HOXC4 homeobox C4 [ Homo sapiens ] |
Official Symbol : | HOXC4 |
Synonyms : | HOXC4; homeobox C4; homeo box C4 , HOX3, HOX3E; homeobox protein Hox-C4; |
Gene ID : | 3221 |
mRNA Refseq : | NM_014620 |
Protein Refseq : | NP_055435 |
MIM : | 142974 |
Uniprot ID : | P09017 |
Chromosome Location : | 12q13.13 |
Function : | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
HOXC4-1954R | Recombinant Rhesus Macaque HOXC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXC4-4979H | Recombinant Human HOXC4 Protein, GST-tagged | +Inquiry |
HOXC4-4292M | Recombinant Mouse HOXC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXC4-2133R | Recombinant Rhesus monkey HOXC4 Protein, His-tagged | +Inquiry |
HOXC4-7808M | Recombinant Mouse HOXC4 Protein | +Inquiry |
◆ Lysates | ||
HOXC4-5417HCL | Recombinant Human HOXC4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket