Recombinant Human HOXC4

Cat.No. : HOXC4-28513TH
Product Overview : Recombinant fragment of Human HOXC4 with N terminal proprietary tag; Predicted MW 37.18 kDa;.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 105 amino acids
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons.
Molecular Weight : 37.180kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQ IKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAAT PGTSEDHSQSATPPEQQRAEDITRL
Sequence Similarities : Belongs to the Antp homeobox family. Deformed subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name HOXC4 homeobox C4 [ Homo sapiens ]
Official Symbol HOXC4
Synonyms HOXC4; homeobox C4; homeo box C4 , HOX3, HOX3E; homeobox protein Hox-C4;
Gene ID 3221
mRNA Refseq NM_014620
Protein Refseq NP_055435
MIM 142974
Uniprot ID P09017
Chromosome Location 12q13.13
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXC4 Products

Required fields are marked with *

My Review for All HOXC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon