Recombinant Human HOXC8

Cat.No. : HOXC8-26894TH
Product Overview : Recombinant fragment of Human HOXC8 with N terminal proprietary tag, 35.53kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXC8 homeobox C8 [ Homo sapiens ]
Official Symbol HOXC8
Synonyms HOXC8; homeobox C8; homeo box C8 , HOX3, HOX3A; homeobox protein Hox-C8;
Gene ID 3224
mRNA Refseq NM_022658
Protein Refseq NP_073149
MIM 142970
Uniprot ID P31273
Chromosome Location 12q13.13
Function sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXC8 Products

Required fields are marked with *

My Review for All HOXC8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon