Recombinant Human HOXC8
Cat.No. : | HOXC8-26894TH |
Product Overview : | Recombinant fragment of Human HOXC8 with N terminal proprietary tag, 35.53kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS |
Sequence Similarities : | Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXC8 homeobox C8 [ Homo sapiens ] |
Official Symbol | HOXC8 |
Synonyms | HOXC8; homeobox C8; homeo box C8 , HOX3, HOX3A; homeobox protein Hox-C8; |
Gene ID | 3224 |
mRNA Refseq | NM_022658 |
Protein Refseq | NP_073149 |
MIM | 142970 |
Uniprot ID | P31273 |
Chromosome Location | 12q13.13 |
Function | sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
HOXC8-7811M | Recombinant Mouse HOXC8 Protein | +Inquiry |
HOXC8-13908H | Recombinant Human HOXC8, GST-tagged | +Inquiry |
HOXC8-3729HF | Recombinant Full Length Human HOXC8 Protein, GST-tagged | +Inquiry |
HOXC8-1893H | Recombinant Human HOXC8 Protein, His-tagged | +Inquiry |
HOXC8-6455C | Recombinant Chicken HOXC8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXC8-5414HCL | Recombinant Human HOXC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC8 Products
Required fields are marked with *
My Review for All HOXC8 Products
Required fields are marked with *