Recombinant Human HPCAL1 Protein, GST-tagged
Cat.No. : | HPCAL1-5004H |
Product Overview : | Human HPCAL1 full-length ORF ( NP_002140.2, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites. [provided by RefSeq |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HPCAL1 hippocalcin-like 1 [ Homo sapiens ] |
Official Symbol | HPCAL1 |
Synonyms | HPCAL1; hippocalcin-like 1; hippocalcin-like protein 1; BDR1; calcium binding protein BDR 1; HLP2; VILIP 3; visinin like protein 3; visinin-like protein 3; calcium-binding protein BDR-1; VILIP-3; |
Gene ID | 3241 |
mRNA Refseq | NM_002149 |
Protein Refseq | NP_002140 |
MIM | 600207 |
UniProt ID | P37235 |
◆ Recombinant Proteins | ||
HPCAL1-6787C | Recombinant Chicken HPCAL1 | +Inquiry |
HPCAL1-2816H | Recombinant Human Hippocalcin-like 1, His-tagged | +Inquiry |
HPCAL1-3619HF | Recombinant Full Length Human HPCAL1 Protein, GST-tagged | +Inquiry |
HPCAL1-5004H | Recombinant Human HPCAL1 Protein, GST-tagged | +Inquiry |
HPCAL1-2898R | Recombinant Rat HPCAL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPCAL1-5406HCL | Recombinant Human HPCAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPCAL1 Products
Required fields are marked with *
My Review for All HPCAL1 Products
Required fields are marked with *
0
Inquiry Basket