Recombinant Human HPCAL1 Protein, GST-tagged

Cat.No. : HPCAL1-5004H
Product Overview : Human HPCAL1 full-length ORF ( NP_002140.2, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites. [provided by RefSeq
Molecular Mass : 48.7 kDa
AA Sequence : MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HPCAL1 hippocalcin-like 1 [ Homo sapiens ]
Official Symbol HPCAL1
Synonyms HPCAL1; hippocalcin-like 1; hippocalcin-like protein 1; BDR1; calcium binding protein BDR 1; HLP2; VILIP 3; visinin like protein 3; visinin-like protein 3; calcium-binding protein BDR-1; VILIP-3;
Gene ID 3241
mRNA Refseq NM_002149
Protein Refseq NP_002140
MIM 600207
UniProt ID P37235

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HPCAL1 Products

Required fields are marked with *

My Review for All HPCAL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon