Recombinant Human HPGD protein, GST-tagged
| Cat.No. : | HPGD-13922H |
| Product Overview : | Recombinant Human HPGD protein(1-266 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-266 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ] |
| Official Symbol | HPGD |
| Synonyms | HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1; PGDH; PGDH1; PHOAR1; 15-PGDH; |
| Gene ID | 3248 |
| mRNA Refseq | NM_000860 |
| Protein Refseq | NP_000851 |
| MIM | 601688 |
| UniProt ID | P15428 |
| ◆ Recombinant Proteins | ||
| HPGD-881H | Active Recombinant Human HPGD protein, His-tagged | +Inquiry |
| HPGD-2564H | Recombinant Human HPGD Protein (Met1-Gln266), C-His tagged | +Inquiry |
| HPGD-4942G | Recombinant Guinea pig HPGD protein, Avi-tagged, Biotinylated | +Inquiry |
| HPGD-4306M | Recombinant Mouse HPGD Protein, His (Fc)-Avi-tagged | +Inquiry |
| HPGD-15H | Recombinant Human HPGD, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPGD-5402HCL | Recombinant Human HPGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPGD Products
Required fields are marked with *
My Review for All HPGD Products
Required fields are marked with *
