Recombinant Human HPGD protein, GST-tagged
Cat.No. : | HPGD-13922H |
Product Overview : | Recombinant Human HPGD protein(1-266 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-266 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ] |
Official Symbol | HPGD |
Synonyms | HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1; PGDH; PGDH1; PHOAR1; 15-PGDH; |
Gene ID | 3248 |
mRNA Refseq | NM_000860 |
Protein Refseq | NP_000851 |
MIM | 601688 |
UniProt ID | P15428 |
◆ Recombinant Proteins | ||
HPGD-5009H | Recombinant Human HPGD Protein, GST-tagged | +Inquiry |
HPGD-2902R | Recombinant Rat HPGD Protein | +Inquiry |
HPGD-4940G | Recombinant Guinea pig HPGD protein | +Inquiry |
HPGD-13922H | Recombinant Human HPGD protein, GST-tagged | +Inquiry |
HPGD-5147H | Recombinant Human HPGD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPGD-5402HCL | Recombinant Human HPGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPGD Products
Required fields are marked with *
My Review for All HPGD Products
Required fields are marked with *