Recombinant Human HPGD, His-tagged
| Cat.No. : | HPGD-15H |
| Product Overview : | Recombinant Human 15-Hydroxyprostaglandin Dehydrogenase [NAD(+)]/HPGD is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln266) of Human HPGD fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| AA Sequence : | MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF IQCD VADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD YMSKQNGG EGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA ICPGFVNTAILE SIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG AIMKITTSKGIHFQDY DTTPFQAKTQVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ] |
| Official Symbol | HPGD |
| Synonyms | HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1; PGDH; PGDH1; PHOAR1; 15-PGDH; |
| Gene ID | 3248 |
| mRNA Refseq | NM_000860 |
| Protein Refseq | NP_000851 |
| MIM | 601688 |
| UniProt ID | P15428 |
| Chromosome Location | 4q34-q35 |
| Pathway | Prostaglandin Synthesis and Regulation, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
| Function | 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; NAD binding; NAD+ binding; catalytic activity; nucleotide binding; oxidoreductase activity; prostaglandin E receptor activity; protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| HPGD-4940G | Recombinant Guinea pig HPGD protein | +Inquiry |
| HPGD-5009H | Recombinant Human HPGD Protein, GST-tagged | +Inquiry |
| HPGD-3624HF | Recombinant Full Length Human HPGD Protein, GST-tagged | +Inquiry |
| HPGD-2564H | Recombinant Human HPGD Protein (Met1-Gln266), C-His tagged | +Inquiry |
| HPGD-43H | Recombinant Human HPGD Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPGD-5402HCL | Recombinant Human HPGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPGD Products
Required fields are marked with *
My Review for All HPGD Products
Required fields are marked with *
