Recombinant Human HPGD, His-tagged
Cat.No. : | HPGD-31206TH |
Product Overview : | Recombinant full length Human Prostaglandin dehydrogenase 1 with an N terminal His tag; 286 amino acids with a predicted MWt 31.1kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 266 amino acids |
Description : | This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 31.100kDa inclusive of tags |
Tissue specificity : | Detected in colon epithelium (at protein level). |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ] |
Official Symbol | HPGD |
Synonyms | HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD+]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; |
Gene ID | 3248 |
mRNA Refseq | NM_000860 |
Protein Refseq | NP_000851 |
MIM | 601688 |
Uniprot ID | P15428 |
Chromosome Location | 4q34-q35 |
Pathway | Prostaglandin Synthesis and Regulation, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; NAD binding; NAD+ binding; catalytic activity; |
◆ Recombinant Proteins | ||
Hpgd-1164M | Recombinant Mouse Hpgd Protein, MYC/DDK-tagged | +Inquiry |
HPGD-13922H | Recombinant Human HPGD, GST-tagged | +Inquiry |
HPGD-31206TH | Recombinant Human HPGD, His-tagged | +Inquiry |
HPGD-2902R | Recombinant Rat HPGD Protein | +Inquiry |
HPGD-3624HF | Recombinant Full Length Human HPGD Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPGD-5402HCL | Recombinant Human HPGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPGD Products
Required fields are marked with *
My Review for All HPGD Products
Required fields are marked with *
0
Inquiry Basket