Recombinant Human HPGD Protein, GST-tagged

Cat.No. : HPGD-5009H
Product Overview : Human HPGD full-length ORF ( AAH18986, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 55.00 kDa
AA Sequence : MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ]
Official Symbol HPGD
Synonyms HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1; PGDH; PGDH1; PHOAR1; 15-PGDH;
Gene ID 3248
mRNA Refseq NM_000860
Protein Refseq NP_000851
MIM 601688
UniProt ID P15428

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HPGD Products

Required fields are marked with *

My Review for All HPGD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon