Recombinant Human HPGDS
| Cat.No. : | HPGDS-30587TH | 
| Product Overview : | Recombinant full length Human Prostaglandin D Synthase produced in Saccharomyces cerevisiae; amino acids 1-199 , 23.3kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Tag : | Non | 
| Protein Length : | 1-199 a.a. | 
| Description : | Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. | 
| Form : | Liquid | 
| Purity : | Immunogen affinity purified | 
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. | 
| Sequences of amino acids : | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWP EIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLA GNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMF NELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEIC STTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRR PQTKL | 
| Full Length : | Full L. | 
| Gene Name | HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ] | 
| Official Symbol | HPGDS | 
| Synonyms | HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS; | 
| Gene ID | 27306 | 
| mRNA Refseq | NM_014485 | 
| Protein Refseq | NP_055300 | 
| MIM | 602598 | 
| Uniprot ID | O60760 | 
| Chromosome Location | 4q22.2 | 
| Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; | 
| Function | calcium ion binding; glutathione transferase activity; isomerase activity; magnesium ion binding; prostaglandin-D synthase activity; | 
| ◆ Recombinant Proteins | ||
| HPGDS-2903R | Recombinant Rat HPGDS Protein | +Inquiry | 
| HPGDS-360H | Recombinant Human HPGDS, His-tagged | +Inquiry | 
| HPGDS-6569C | Recombinant Chicken HPGDS | +Inquiry | 
| HPGDS-0141H | Recombinant Human HPGDS Protein (M1-L199), Tag Free | +Inquiry | 
| HPGDS-3517H | Recombinant Human HPGDS Protein (Met1-Leu199), N-His tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| HPGDS-5401HCL | Recombinant Human HPGDS 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPGDS Products
Required fields are marked with *
My Review for All HPGDS Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            