Recombinant Human HPGDS
Cat.No. : | HPGDS-30587TH |
Product Overview : | Recombinant full length Human Prostaglandin D Synthase produced in Saccharomyces cerevisiae; amino acids 1-199 , 23.3kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-199 a.a. |
Description : | Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. |
Form : | Liquid |
Purity : | Immunogen affinity purified |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWP EIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLA GNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMF NELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEIC STTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRR PQTKL |
Full Length : | Full L. |
Gene Name | HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ] |
Official Symbol | HPGDS |
Synonyms | HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS; |
Gene ID | 27306 |
mRNA Refseq | NM_014485 |
Protein Refseq | NP_055300 |
MIM | 602598 |
Uniprot ID | O60760 |
Chromosome Location | 4q22.2 |
Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | calcium ion binding; glutathione transferase activity; isomerase activity; magnesium ion binding; prostaglandin-D synthase activity; |
◆ Recombinant Proteins | ||
HPGDS-55H | Recombinant Human HPGDS Protein, His-tagged | +Inquiry |
Hpgds-38M | Recombinant Mouse Hpgds Protein | +Inquiry |
HPGDS-2138R | Recombinant Rhesus monkey HPGDS Protein, His-tagged | +Inquiry |
HPGDS-1007H | Active Recombinant Human HPGDS Protein, His-tagged | +Inquiry |
HPGDS-2903R | Recombinant Rat HPGDS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPGDS-5401HCL | Recombinant Human HPGDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPGDS Products
Required fields are marked with *
My Review for All HPGDS Products
Required fields are marked with *
0
Inquiry Basket