Recombinant Human HPGDS Protein
| Cat.No. : | HPGDS-314H |
| Product Overview : | Recombinant Human HPGDS was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 200mM NaCl, pH 7.0 |
| Molecular Mass : | 23.6kD |
| AA Sequence : | GSHMPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ] |
| Official Symbol | HPGDS |
| Synonyms | HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS; GST class-sigma; prostaglandin-H2 D-isomerase; glutathione S-transferase sigma; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; hematopoietic prostaglandin D2 synthase; glutathione-requiring prostaglandin D synthase; |
| Gene ID | 27306 |
| mRNA Refseq | NM_014485 |
| Protein Refseq | NP_055300 |
| MIM | 602598 |
| UniProt ID | O60760 |
| ◆ Recombinant Proteins | ||
| HPGDS-55H | Recombinant Human HPGDS Protein, His-tagged | +Inquiry |
| HPGDS-2903R | Recombinant Rat HPGDS Protein | +Inquiry |
| Hpgds-38M | Recombinant Mouse Hpgds Protein | +Inquiry |
| HPGDS-165H | Recombinant Human HPGDS Protein, His-tagged | +Inquiry |
| HPGDS-2402H | Recombinant Human Hematopoietic Prostaglandin D Synthase, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPGDS-5401HCL | Recombinant Human HPGDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPGDS Products
Required fields are marked with *
My Review for All HPGDS Products
Required fields are marked with *
