Recombinant Human HPGDS Protein

Cat.No. : HPGDS-314H
Product Overview : Recombinant Human HPGDS was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris, 200mM NaCl, pH 7.0
Molecular Mass : 23.6kD
AA Sequence : GSHMPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ]
Official Symbol HPGDS
Synonyms HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS; GST class-sigma; prostaglandin-H2 D-isomerase; glutathione S-transferase sigma; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; hematopoietic prostaglandin D2 synthase; glutathione-requiring prostaglandin D synthase;
Gene ID 27306
mRNA Refseq NM_014485
Protein Refseq NP_055300
MIM 602598
UniProt ID O60760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HPGDS Products

Required fields are marked with *

My Review for All HPGDS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon