Recombinant Human HPGDS Protein

• Cat.No.: HPGDS-314H
• Product Overview: Recombinant Human HPGDS was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris, 200mM NaCl, pH 7.0
• Molecular Mass: 23.6kD
• AA Sequence: GSHMPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ]
• Official Symbol: HPGDS
• Synonyms: HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS; GST class-sigma; prostaglandin-H2 D-isomerase; glutathione S-transferase sigma; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; hematopoietic prostaglandin D2 synthase; glutathione-requiring prostaglandin D synthase
• Gene ID: 27306
• mRNA Refseq: NM_014485
• Protein Refseq: NP_055300
• MIM: 602598
• UniProt ID: O60760