Recombinant Human HR Protein, GST-tagged
Cat.No. : | HR-5022H |
Product Overview : | Human HR partial ORF ( NP_005135, 1090 a.a. - 1189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is involved in hair growth. This protein functions as a transcriptional corepressor of multiple nuclear receptors, including thyroid hormone receptor, the retinoic acid receptor-related orphan receptors and the vitamin D receptors, and it interacts with histone deacetylases. The translation of this protein is modulated by multiple regulatory ORFs that exist upstream of the primary ORF. Mutations in one of these upstream ORFs, U2HR, cause Marie Unna hereditary hypotrichosis (MUHH), an autosomal dominant form of genetic hair loss. Mutations in this gene also cause autosomal recessive congenital alopecia and atrichia with papular lesions, other diseases resulting in hair loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHFLSPETSALSAQLCHQGPSLPPDCHLLYAQMDWAVFQAVKVAVGTLQEAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HR hairless homolog (mouse) [ Homo sapiens ] |
Official Symbol | HR |
Synonyms | HR; hairless homolog (mouse); ALUNC, hairless (mouse) homolog; AU; ALUNC; |
Gene ID | 3264 |
MIM | 602302 |
UniProt ID | O43593 |
◆ Recombinant Proteins | ||
HR-4313M | Recombinant Mouse HR Protein, His (Fc)-Avi-tagged | +Inquiry |
HR-1961R | Recombinant Rhesus Macaque HR Protein, His (Fc)-Avi-tagged | +Inquiry |
HR-13933H | Recombinant Human HR, GST-tagged | +Inquiry |
HR-3980H | Recombinant Human HR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hr-1168M | Recombinant Mouse Hr Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HR Products
Required fields are marked with *
My Review for All HR Products
Required fields are marked with *