Recombinant Human HRAS protein, His-tagged

• Cat.No.: HRAS-13934H
• Product Overview: Recombinant Human HRAS protein(1-170 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-170 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSSGTLWDPPGPM

Gene Information

• Gene Name: HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog [ Homo sapiens ]
• Official Symbol: HRAS
• Synonyms: HRAS; v-Ha-ras Harvey rat sarcoma viral oncogene homolog; HRAS1; GTPase HRas; p21ras; H-Ras-1; p19 H-RasIDX protein; c-has/bas p21 protein; transforming protein p21; Ha-Ras1 proto-oncoprotein; c-ras-Ki-2 activated oncogene; GTP- and GDP-binding peptide B; transformation gene: oncogene HAMSV; Ras family small GTP binding protein H-Ras; CTLO; HAMSV; K-RAS; N-RAS; RASH1; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1
• Gene ID: 3265
• mRNA Refseq: NM_001130442
• Protein Refseq: NP_001123914
• MIM: 190020
• UniProt ID: P01112