Recombinant Human HRASLS5 Protein, GST-tagged
Cat.No. : | HRASLS5-5028H |
Product Overview : | Human HRASLS5 full-length ORF ( AAH34222.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HRASLS5 (HRAS Like Suppressor Family Member 5) is a Protein Coding gene. Diseases associated with HRASLS5 include Poland Syndrome and Myasthenic Syndrome, Congenital, 5. Among its related pathways are Acyl chain remodelling of PE and Glycerophospholipid biosynthesis. GO annotations related to this gene include transferase activity, transferring acyl groups. An important paralog of this gene is RARRES3. |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MGLSPGAEGEYALRLPRIPPPLPKPASRTAGTGPKDQPPALRRSAVPHSEESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HRASLS5 HRAS-like suppressor family, member 5 [ Homo sapiens ] |
Official Symbol | HRASLS5 |
Synonyms | HRASLS5; HRAS-like suppressor family, member 5; HRAS-like suppressor 5; HRLP5; H-rev107-like protein 5; lecithin-retinol acyltransferase (LRAT)-like protein-1; calcium-independent phosphatidylethanolamine N-acyltransferase; RLP1; iNAT; |
Gene ID | 117245 |
mRNA Refseq | NM_001146728 |
Protein Refseq | NP_001140200 |
MIM | 611474 |
UniProt ID | Q96KN8 |
◆ Recombinant Proteins | ||
HRASLS5-2142R | Recombinant Rhesus monkey HRASLS5 Protein, His-tagged | +Inquiry |
HRASLS5-1963R | Recombinant Rhesus Macaque HRASLS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HRASLS5-2134H | Recombinant Human HRASLS5 Protein, His-tagged | +Inquiry |
HRASLS5-3653HF | Recombinant Full Length Human HRASLS5 Protein, GST-tagged | +Inquiry |
HRASLS5-5028H | Recombinant Human HRASLS5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRASLS5-337HCL | Recombinant Human HRASLS5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRASLS5 Products
Required fields are marked with *
My Review for All HRASLS5 Products
Required fields are marked with *