Recombinant Human HSD17B1
Cat.No. : | HSD17B1-27735TH |
Product Overview : | Recombinant fragment of Human HSD17B1 (aa 189-285) with N-terminal proprietary tag, 36.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 97 amino acids |
Description : | Estradiol 17-beta-dehydrogenase 1 is an enzyme that in humans is encoded by the HSD17B1 gene. |
Molecular Weight : | 36.300kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | HSD17B1 hydroxysteroid (17-beta) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | HSD17B1 |
Synonyms | HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta-dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short chain dehydrogenase/reductase family 28CE; member 1; |
Gene ID | 3292 |
mRNA Refseq | NM_000413 |
Protein Refseq | NP_000404 |
MIM | 109684 |
Uniprot ID | P14061 |
Chromosome Location | 17q11-q21 |
Pathway | Estrogen biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Steroid Biosynthesis, organism-specific biosystem; |
Function | catalytic activity; estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
HSD17B1-6400C | Recombinant Chicken HSD17B1 | +Inquiry |
HSD17B1-4356H | Recombinant Human HSD17B1 protein, His&Myc-tagged | +Inquiry |
HSD17B1-5062H | Recombinant Human HSD17B1 Protein, GST-tagged | +Inquiry |
HSD17B1-2404H | Recombinant Human HSD17B1 Protein (Thr4-Pro289), N-His tagged | +Inquiry |
HSD17B1-1973R | Recombinant Rhesus Macaque HSD17B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B1 Products
Required fields are marked with *
My Review for All HSD17B1 Products
Required fields are marked with *
0
Inquiry Basket