Recombinant Human HSD17B1
| Cat.No. : | HSD17B1-27735TH |
| Product Overview : | Recombinant fragment of Human HSD17B1 (aa 189-285) with N-terminal proprietary tag, 36.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 97 amino acids |
| Description : | Estradiol 17-beta-dehydrogenase 1 is an enzyme that in humans is encoded by the HSD17B1 gene. |
| Molecular Weight : | 36.300kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF |
| Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Gene Name | HSD17B1 hydroxysteroid (17-beta) dehydrogenase 1 [ Homo sapiens ] |
| Official Symbol | HSD17B1 |
| Synonyms | HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta-dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short chain dehydrogenase/reductase family 28CE; member 1; |
| Gene ID | 3292 |
| mRNA Refseq | NM_000413 |
| Protein Refseq | NP_000404 |
| MIM | 109684 |
| Uniprot ID | P14061 |
| Chromosome Location | 17q11-q21 |
| Pathway | Estrogen biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Steroid Biosynthesis, organism-specific biosystem; |
| Function | catalytic activity; estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity; |
| ◆ Recombinant Proteins | ||
| HSD17B1-603HFL | Recombinant Full Length Human HSD17B1 Protein, C-Flag-tagged | +Inquiry |
| HSD17B1-586H | Recombinant Human hydroxysteroid (17-beta) dehydrogenase 1, His-tagged | +Inquiry |
| HSD17B1-7871M | Recombinant Mouse HSD17B1 Protein | +Inquiry |
| HSD17B1-2922R | Recombinant Rat HSD17B1 Protein | +Inquiry |
| HSD17B1-1100H | Recombinant Human HSD17B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B1 Products
Required fields are marked with *
My Review for All HSD17B1 Products
Required fields are marked with *



