Recombinant Human HSD17B12, GST-tagged

Cat.No. : HSD17B12-46H
Product Overview : Recombinant Human HSD17B12(1 a.a. - 98 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation.
Molecular Mass : 36.7 kDa
AA Sequence : MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGM KVVLISRSKDKLDQVSSEISNYT
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [Homo sapiens]
Official Symbol HSD17B12
Synonyms HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; 17beta-HSD type 12; KAR; estradiol 17-beta-dehydrogenase 12; SDR12C1; short chain dehydrogenase/reductase family 12C, member 1; 17-beta-HSD 12; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; EC 1.1.1.62; 3-ketoacyl-CoA reductase; EC 1.3.1.-; OTTHUMP00000232808
Gene ID 51144
mRNA Refseq NM_016142
Protein Refseq NP_057226
MIM 609574
UniProt ID Q53GQ0
Chromosome Location 11p11.2
Pathway Androgen biosynthesis; Fatty acid biosynthesis; Metabolism
Function collagen binding; estradiol 17-beta-dehydrogenase activity; fibronectin binding; heparin binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B12 Products

Required fields are marked with *

My Review for All HSD17B12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon