Recombinant Human HSD17B2, GST-tagged
Cat.No. : | HSD17B2-206H |
Product Overview : | Recombinant Human HSD17B2(1 a.a. - 387 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Estradiol 17-beta-dehydrogenase 2 is an enzyme that in humans is encoded by the HSD17B2 gene. |
Molecular Mass : | 68.31 kDa |
AA Sequence : | MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQ ELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYS KVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAP MERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPR ALRMPNYKKKAT |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSD17B2 hydroxysteroid (17-beta) dehydrogenase 2 [ Homo sapiens (human) ] |
Official Symbol | HSD17B2 |
Synonyms | HSD17B2; hydroxysteroid (17-beta) dehydrogenase 2; estradiol 17-beta-dehydrogenase 2; HSD17; SDR9C2; short chain dehydrogenase/reductase family 9C; member 2; 17 beta HSD 2; 20 alpha HSD; 20 alpha hydroxysteroid dehydrogenase; E2DH; Microsomal 17 beta hydroxysteroid dehydrogenase; Testosterone 17 beta dehydrogenase; E2DH; 20-alpha-HSD; 17-beta-HSD 2; OTTHUMP00000174979; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C, member 2; EDH17B2 |
Gene ID | 3294 |
mRNA Refseq | NM_002153 |
Protein Refseq | NP_002144 |
MIM | 109685 |
UniProt ID | P37059 |
Chromosome Location | 16q24.1-q24.2 |
Pathway | Metabolic pathways; Ovarian steroidogenesis; Steroid Biosynthesis |
Function | 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity; estradiol 17-beta-dehydrogenase activity; testosterone dehydrogenase (NAD+) activity |
◆ Recombinant Proteins | ||
RFL31495MF | Recombinant Full Length Mouse Estradiol 17-Beta-Dehydrogenase 2(Hsd17B2) Protein, His-Tagged | +Inquiry |
HSD17B2-99HFL | Recombinant Full Length Human HSD17B2 Protein, C-Flag-tagged | +Inquiry |
HSD17B2-2926R | Recombinant Rat HSD17B2 Protein | +Inquiry |
HSD17B2-346C | Recombinant Cynomolgus Monkey HSD17B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hsd17b2-1178M | Recombinant Mouse Hsd17b2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B2-5375HCL | Recombinant Human HSD17B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B2 Products
Required fields are marked with *
My Review for All HSD17B2 Products
Required fields are marked with *
0
Inquiry Basket