Recombinant Human HSDL1 Protein, GST-tagged

Cat.No. : HSDL1-5083H
Product Overview : Human HSDL1 full-length ORF ( NP_113651.3, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HSDL1 (Hydroxysteroid Dehydrogenase Like 1) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is HSD17B12.
Molecular Mass : 63.4 kDa
AA Sequence : MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALCCTA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSDL1 hydroxysteroid dehydrogenase like 1 [ Homo sapiens ]
Official Symbol HSDL1
Synonyms HSDL1; hydroxysteroid dehydrogenase like 1; inactive hydroxysteroid dehydrogenase-like protein 1; SDR12C3; short chain dehydrogenase/reductase family 12C; member 3; steroid dehydrogenase-like protein; short chain dehydrogenase/reductase family 12C, member 3; MGC125994; MGC125995; MGC126032;
Gene ID 83693
mRNA Refseq NM_001146051
Protein Refseq NP_001139523
UniProt ID Q3SXM5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSDL1 Products

Required fields are marked with *

My Review for All HSDL1 Products

Required fields are marked with *

0
cart-icon