Recombinant Human HSF1 protein, Arginine-tagged
| Cat.No. : | HSF1-205H |
| Product Overview : | Recombinant human HSF1 protein fused with 11 arginine domain at C-terminal which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 1-529 a.a. |
| Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | 29aa_Tag_DLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMA SFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLT DVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSG SAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSS PLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPT STPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQEL LSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTG SEPPKAKDPTVSLEESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein transduction for study of hepatocytes cell metabolic pathway regulation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. As immunogen for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | HSF1 heat shock transcription factor 1 [ Homo sapiens ] |
| Official Symbol | HSF1 |
| Synonyms | HSF1; heat shock transcription factor 1; heat shock factor protein 1; HSTF1; HSF 1; HSTF 1; |
| Gene ID | 3297 |
| mRNA Refseq | NM_005526 |
| Protein Refseq | NP_005517 |
| MIM | 140580 |
| UniProt ID | Q00613 |
| Chromosome Location | 8q24.3 |
| Pathway | Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; |
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| HSF1-4849H | Recombinant Human Heat Shock Transcription Factor 1, GST-tagged | +Inquiry |
| HSF1-13969H | Recombinant Human HSF1, GST-tagged | +Inquiry |
| HSF1-26697TH | Recombinant Human HSF1, His-tagged | +Inquiry |
| HSF1-29387TH | Recombinant Human HSF1, His-tagged | +Inquiry |
| HSF1-658H | Recombinant Human HSF1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSF1-004HKCL | Human HSF1 Knockdown Cell Lysate | +Inquiry |
| HSF1-339HCL | Recombinant Human HSF1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSF1 Products
Required fields are marked with *
My Review for All HSF1 Products
Required fields are marked with *
