Recombinant Human HSF2 Protein, GST-tagged
| Cat.No. : | HSF2-5087H |
| Product Overview : | Human HSF2 full-length ORF ( AAH05329, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. [provided by RefSeq |
| Molecular Mass : | 51.04 kDa |
| AA Sequence : | MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSF2 heat shock transcription factor 2 [ Homo sapiens ] |
| Official Symbol | HSF2 |
| Synonyms | HSF2; heat shock transcription factor 2; heat shock factor protein 2; HSF 2; HSTF 2; MGC75048; MGC117376; MGC156196; |
| Gene ID | 3298 |
| mRNA Refseq | NM_001135564 |
| Protein Refseq | NP_001129036 |
| MIM | 140581 |
| UniProt ID | Q03933 |
| ◆ Recombinant Proteins | ||
| HSF2-3888HF | Recombinant Full Length Human HSF2 Protein, GST-tagged | +Inquiry |
| HSF2-7890M | Recombinant Mouse HSF2 Protein | +Inquiry |
| HSF2-700H | Recombinant Human HSF2 Protein, His/GST-tagged | +Inquiry |
| HSF2-4032C | Recombinant Chicken HSF2 | +Inquiry |
| Hsf2-1184M | Recombinant Mouse Hsf2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSF2-5366HCL | Recombinant Human HSF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSF2 Products
Required fields are marked with *
My Review for All HSF2 Products
Required fields are marked with *



