Recombinant Human HSF2 Protein, GST-tagged
Cat.No. : | HSF2-5087H |
Product Overview : | Human HSF2 full-length ORF ( AAH05329, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. [provided by RefSeq |
Molecular Mass : | 51.04 kDa |
AA Sequence : | MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSF2 heat shock transcription factor 2 [ Homo sapiens ] |
Official Symbol | HSF2 |
Synonyms | HSF2; heat shock transcription factor 2; heat shock factor protein 2; HSF 2; HSTF 2; MGC75048; MGC117376; MGC156196; |
Gene ID | 3298 |
mRNA Refseq | NM_001135564 |
Protein Refseq | NP_001129036 |
MIM | 140581 |
UniProt ID | Q03933 |
◆ Recombinant Proteins | ||
HSF2-2757H | Recombinant Human HSF2 Protein (Glu294-Tyr518), N-His tagged | +Inquiry |
HSF2-5451H | Recombinant Human HSF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSF2-7890M | Recombinant Mouse HSF2 Protein | +Inquiry |
HSF2-4032C | Recombinant Chicken HSF2 | +Inquiry |
HSF2-5087H | Recombinant Human HSF2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF2-5366HCL | Recombinant Human HSF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSF2 Products
Required fields are marked with *
My Review for All HSF2 Products
Required fields are marked with *