Recombinant Human HSF4
Cat.No. : | HSF4-29388TH |
Product Overview : | Recombinant fragment of Human HSF4 with a N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC |
Sequence Similarities : | Belongs to the HSF family. |
Gene Name | HSF4 heat shock transcription factor 4 [ Homo sapiens ] |
Official Symbol | HSF4 |
Synonyms | HSF4; heat shock transcription factor 4; cataract, Marner , CTM; heat shock factor protein 4; |
Gene ID | 3299 |
mRNA Refseq | NM_001040667 |
Protein Refseq | NP_001035757 |
MIM | 602438 |
Uniprot ID | Q9ULV5 |
Chromosome Location | 16q21 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; |
◆ Recombinant Proteins | ||
HSF4-5662H | Recombinant Human HSF4 protein, His & GST-tagged | +Inquiry |
HSF4-29388TH | Recombinant Human HSF4 | +Inquiry |
HSF4-5091H | Recombinant Human HSF4 Protein, GST-tagged | +Inquiry |
HSF4-716H | Recombinant Human HSF4 Protein, His-tagged | +Inquiry |
HSF4-2675H | Recombinant Human HSF4 Protein (Val171-Arg284), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF4-821HCL | Recombinant Human HSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSF4 Products
Required fields are marked with *
My Review for All HSF4 Products
Required fields are marked with *
0
Inquiry Basket