Recombinant Human HSPA8 protein(401-620 aa), C-His-tagged
| Cat.No. : | HSPA8-2634H |
| Product Overview : | Recombinant Human HSPA8 protein(P11142)(401-620 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 401-620 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGG |
| Gene Name | HSPA8 heat shock 70kDa protein 8 [ Homo sapiens ] |
| Official Symbol | HSPA8 |
| Synonyms | HSPA8; heat shock 70kDa protein 8; heat shock 70kD protein 8 , HSPA10; heat shock cognate 71 kDa protein; HSC70; HSC71; HSP73; LPS-associated protein 1; heat shock 70kd protein 10; heat shock cognate protein 54; constitutive heat shock protein 70; lipopolysaccharide-associated protein 1; N-myristoyltransferase inhibitor protein 71; LAP1; HSC54; HSP71; NIP71; HSPA10; MGC29929; MGC131511; |
| Gene ID | 3312 |
| mRNA Refseq | NM_006597 |
| Protein Refseq | NP_006588 |
| MIM | 600816 |
| UniProt ID | P11142 |
| ◆ Recombinant Proteins | ||
| Hspa8-1174M | Recombinant Mouse Hspa8 Protein, MYC/DDK-tagged | +Inquiry |
| HSPA8-1809H | Recombinant Human Heat Shock 70kDa Protein 8 | +Inquiry |
| HSPA8-2166R | Recombinant Rhesus monkey HSPA8 Protein, His-tagged | +Inquiry |
| HSPA8-2604R | Recombinant Rat HSPA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSPA8-8258C | Recombinant Chicken HSPA8 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPA8-006HKCL | Human HSPA8 Knockdown Cell Lysate | +Inquiry |
| HSPA8-5353HCL | Recombinant Human HSPA8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA8 Products
Required fields are marked with *
My Review for All HSPA8 Products
Required fields are marked with *




