Recombinant Human HSPA8 protein(401-620 aa), C-His-tagged

Cat.No. : HSPA8-2634H
Product Overview : Recombinant Human HSPA8 protein(P11142)(401-620 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 401-620 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGG
Gene Name HSPA8 heat shock 70kDa protein 8 [ Homo sapiens ]
Official Symbol HSPA8
Synonyms HSPA8; heat shock 70kDa protein 8; heat shock 70kD protein 8 , HSPA10; heat shock cognate 71 kDa protein; HSC70; HSC71; HSP73; LPS-associated protein 1; heat shock 70kd protein 10; heat shock cognate protein 54; constitutive heat shock protein 70; lipopolysaccharide-associated protein 1; N-myristoyltransferase inhibitor protein 71; LAP1; HSC54; HSP71; NIP71; HSPA10; MGC29929; MGC131511;
Gene ID 3312
mRNA Refseq NM_006597
Protein Refseq NP_006588
MIM 600816
UniProt ID P11142

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPA8 Products

Required fields are marked with *

My Review for All HSPA8 Products

Required fields are marked with *

0
cart-icon