Recombinant Human HSPA8 protein, His-tagged
Cat.No. : | HSPA8-7843H |
Product Overview : | Recombinant Human HSPA8 protein(288-587 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 288-587 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
HSPA8-1809H | Recombinant Human Heat Shock 70kDa Protein 8 | +Inquiry |
HSPA8-2166R | Recombinant Rhesus monkey HSPA8 Protein, His-tagged | +Inquiry |
HSPA8-276H | Recombinant Human HSPA8 protein, His/MBP-tagged | +Inquiry |
HSPA8-2650B | Recombinant Bovine Heat Shock 70kDa Protein 8 | +Inquiry |
HSPA8-4358M | Recombinant Mouse HSPA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA8-5353HCL | Recombinant Human HSPA8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA8 Products
Required fields are marked with *
My Review for All HSPA8 Products
Required fields are marked with *
0
Inquiry Basket