Recombinant Human HSPB1 protein, GST-tagged
| Cat.No. : | HSPB1-13990H |
| Product Overview : | Recombinant Human HSPB1 protein(1-205 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 31, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-205 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HSPB1 heat shock 27kDa protein 1 [ Homo sapiens ] |
| Official Symbol | HSPB1 |
| Synonyms | HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322; |
| Gene ID | 3315 |
| mRNA Refseq | NM_001540 |
| Protein Refseq | NP_001531 |
| MIM | 602195 |
| UniProt ID | P04792 |
| ◆ Recombinant Proteins | ||
| HSPB1-1554H | Recombinant Human HSPB1 Full Length protein, His-tagged | +Inquiry |
| HSPB1-3964HF | Recombinant Full Length Human HSPB1 Protein, GST-tagged | +Inquiry |
| HSPB1-5114H | Recombinant Human HSPB1 Protein, GST-tagged | +Inquiry |
| HSPB1-813C | Recombinant Cattle HSPB1 protein, His & T7-tagged | +Inquiry |
| HSPB1-4853H | Recombinant Human Heat Shock 27kDa Protein 1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB1-5351HCL | Recombinant Human HSPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB1 Products
Required fields are marked with *
My Review for All HSPB1 Products
Required fields are marked with *
