Recombinant Human HSPB1 Protein, GST-tagged
| Cat.No. : | HSPB1-5114H |
| Product Overview : | Human HSPB1 full-length ORF ( NP_001531.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq |
| Molecular Mass : | 49.2 kDa |
| AA Sequence : | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPB1 heat shock 27kDa protein 1 [ Homo sapiens ] |
| Official Symbol | HSPB1 |
| Synonyms | HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322; |
| Gene ID | 3315 |
| mRNA Refseq | NM_001540 |
| Protein Refseq | NP_001531 |
| MIM | 602195 |
| UniProt ID | P04792 |
| ◆ Recombinant Proteins | ||
| HSPB1-1988R | Recombinant Rhesus Macaque HSPB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSPB1-1554H | Recombinant Human HSPB1 Full Length protein, His-tagged | +Inquiry |
| HSPB1-1825H | Recombinant Human Heat Shock Protein Beta-1, His tagged | +Inquiry |
| HSPB1-13990H | Recombinant Human HSPB1 protein, GST-tagged | +Inquiry |
| HSPB1-971H | Recombinant Human HSPB1 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| HSPB1-1553H | Recombinant Human HSPB1 Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB1-5351HCL | Recombinant Human HSPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB1 Products
Required fields are marked with *
My Review for All HSPB1 Products
Required fields are marked with *
