Recombinant Human HSPB2 protein, GST-tagged
| Cat.No. : | HSPB2-4384H |
| Product Overview : | Recombinant Human HSPB2 protein(Q16082)(1-182aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-182aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HSPB2 heat shock 27kDa protein 2 [ Homo sapiens ] |
| Official Symbol | HSPB2 |
| Synonyms | HSPB2; heat shock 27kDa protein 2; heat shock 27kD protein 2; heat shock protein beta-2; Hs.78846; MKBP; DMPK-binding protein; heat-shock protein beta-2; HSP27; LOH11CR1K; MGC133245; |
| Gene ID | 3316 |
| mRNA Refseq | NM_001541 |
| Protein Refseq | NP_001532 |
| MIM | 602179 |
| UniProt ID | Q16082 |
| ◆ Recombinant Proteins | ||
| HSPB2-1255H | Recombinant Human Heat Shock 27kDa Protein 2 | +Inquiry |
| HSPB2-3105H | Recombinant Human HSPB2, His tagged | +Inquiry |
| HSPB2-6779H | Recombinant Human Heat Shock 27kDa Protein 2, His-tagged | +Inquiry |
| Hspb2-7862M | Recombinant Mouse Hspb2 protein, His & T7-tagged | +Inquiry |
| HSPB2-4362M | Recombinant Mouse HSPB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB2-5349HCL | Recombinant Human HSPB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB2 Products
Required fields are marked with *
My Review for All HSPB2 Products
Required fields are marked with *
