Recombinant Human HSPB6 Protein

Cat.No. : HSPB6-044H
Product Overview : Recombinant human HSPB6 protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 172
Description : This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.
Form : Lyophilized
Molecular Mass : 20 kDa
AA Sequence : MALWPVDRFERMMMEDPMRAMDRFGRMGDMDHWMSRRMMPYWRDADHSMLHVGNQKEVINDDKKFAVSLDVKHFKPNELKVQLDDRDLTVEGMQEVKTEHGYIKKQFVHRWSLPEDCDLDAVHTELDNHGHLSIEAPEDGPSQKFQSSAHSSSAEEEEVGDIEPVNKRILYK
Purity : > 95%
Applications : WB
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : Tris-acetate (pH 7.6). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name HSPB6 heat shock protein, alpha-crystallin-related, B6 [ Homo sapiens (human) ]
Official Symbol HSPB6
Synonyms HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20;
Gene ID 126393
mRNA Refseq NM_144617
Protein Refseq NP_653218
MIM 610695
UniProt ID O14558

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB6 Products

Required fields are marked with *

My Review for All HSPB6 Products

Required fields are marked with *

0
cart-icon
0
compare icon