Recombinant Human HSPB6 Protein
Cat.No. : | HSPB6-044H |
Product Overview : | Recombinant human HSPB6 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 172 |
Description : | This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. |
Form : | Lyophilized |
Molecular Mass : | 20 kDa |
AA Sequence : | MALWPVDRFERMMMEDPMRAMDRFGRMGDMDHWMSRRMMPYWRDADHSMLHVGNQKEVINDDKKFAVSLDVKHFKPNELKVQLDDRDLTVEGMQEVKTEHGYIKKQFVHRWSLPEDCDLDAVHTELDNHGHLSIEAPEDGPSQKFQSSAHSSSAEEEEVGDIEPVNKRILYK |
Purity : | > 95% |
Applications : | WB |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris-acetate (pH 7.6). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | HSPB6 heat shock protein, alpha-crystallin-related, B6 [ Homo sapiens (human) ] |
Official Symbol | HSPB6 |
Synonyms | HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20; |
Gene ID | 126393 |
mRNA Refseq | NM_144617 |
Protein Refseq | NP_653218 |
MIM | 610695 |
UniProt ID | O14558 |
◆ Recombinant Proteins | ||
HSPB6-044H | Recombinant Human HSPB6 Protein | +Inquiry |
HSPB6-28486TH | Recombinant Human HSPB6 | +Inquiry |
HSPB6-13992H | Recombinant Human HSPB6, His-tagged | +Inquiry |
HSPB6-2169R | Recombinant Rhesus monkey HSPB6 Protein, His-tagged | +Inquiry |
HSPB6-5117H | Recombinant Human HSPB6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB6-5347HCL | Recombinant Human HSPB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB6 Products
Required fields are marked with *
My Review for All HSPB6 Products
Required fields are marked with *