Recombinant Human HSPB6 Protein
| Cat.No. : | HSPB6-044H |
| Product Overview : | Recombinant human HSPB6 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 172 |
| Description : | This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. |
| Form : | Lyophilized |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MALWPVDRFERMMMEDPMRAMDRFGRMGDMDHWMSRRMMPYWRDADHSMLHVGNQKEVINDDKKFAVSLDVKHFKPNELKVQLDDRDLTVEGMQEVKTEHGYIKKQFVHRWSLPEDCDLDAVHTELDNHGHLSIEAPEDGPSQKFQSSAHSSSAEEEEVGDIEPVNKRILYK |
| Purity : | > 95% |
| Applications : | WB |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | Tris-acetate (pH 7.6). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | HSPB6 heat shock protein, alpha-crystallin-related, B6 [ Homo sapiens (human) ] |
| Official Symbol | HSPB6 |
| Synonyms | HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20; |
| Gene ID | 126393 |
| mRNA Refseq | NM_144617 |
| Protein Refseq | NP_653218 |
| MIM | 610695 |
| UniProt ID | O14558 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB6 Products
Required fields are marked with *
My Review for All HSPB6 Products
Required fields are marked with *



