Recombinant Human HSPB7 protein, T7-tagged

Cat.No. : HSPB7-172H
Product Overview : Recombinant human HSPB7 (170 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 170 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPT SVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human cardiomyocytes differentiation / stress regulations study with recombinant HSPB7 protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for Kinase, ubiquitin assay.3. May be used for mapping HSPB7 protein binding partner in protein–protein interaction assay.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ]
Official Symbol HSPB7
Synonyms HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP; cardiovascular heat shock protein; FLJ32733; DKFZp779D0968;
Gene ID 27129
mRNA Refseq NM_014424
Protein Refseq NP_055239
MIM 610692
UniProt ID Q9UBY9
Chromosome Location 1p36.23-p34.3
Function protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB7 Products

Required fields are marked with *

My Review for All HSPB7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon