"HSPB7" Related Products

Expand
Expand

Recombinant Human HSPB7 protein, T7-tagged

Cat.No.: HSPB7-172H
Product Overview: Recombinant human HSPB7 (170 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPT SVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human cardiomyocytes differentiation / stress regulations study with recombinant HSPB7 protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for Kinase, ubiquitin assay.3. May be used for mapping HSPB7 protein binding partner in protein–protein interaction assay.4. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ]
Official Symbol: HSPB7
Synonyms: HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP; cardiovascular heat shock protein; FLJ32733; DKFZp779D0968;
Gene ID: 27129
mRNA Refseq: NM_014424
Protein Refseq: NP_055239
MIM: 610692
UniProt ID: Q9UBY9
Chromosome Location: 1p36.23-p34.3
Function: protein C-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.