Recombinant Human HSPB7 protein, T7-tagged
Cat.No. : | HSPB7-172H |
Product Overview : | Recombinant human HSPB7 (170 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 170 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPT SVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human cardiomyocytes differentiation / stress regulations study with recombinant HSPB7 protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for Kinase, ubiquitin assay.3. May be used for mapping HSPB7 protein binding partner in protein–protein interaction assay.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ] |
Official Symbol | HSPB7 |
Synonyms | HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP; cardiovascular heat shock protein; FLJ32733; DKFZp779D0968; |
Gene ID | 27129 |
mRNA Refseq | NM_014424 |
Protein Refseq | NP_055239 |
MIM | 610692 |
UniProt ID | Q9UBY9 |
Chromosome Location | 1p36.23-p34.3 |
Function | protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
HSPB7-26655TH | Recombinant Human HSPB7, T7 -tagged | +Inquiry |
HSPB7-172H | Recombinant Human HSPB7 protein, T7-tagged | +Inquiry |
HSPB7-1554Z | Recombinant Zebrafish HSPB7 | +Inquiry |
HSPB7-2047H | Recombinant Human HSPB7, His-tagged | +Inquiry |
HSPB7-5118H | Recombinant Human HSPB7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB7-5346HCL | Recombinant Human HSPB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB7 Products
Required fields are marked with *
My Review for All HSPB7 Products
Required fields are marked with *