Recombinant Human HSPBAP1 protein, His-tagged
| Cat.No. : | HSPBAP1-3886H |
| Product Overview : | Recombinant Human HSPBAP1 protein(273-451 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 273-451 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | IELEEDHLARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HSPBAP1 HSPB (heat shock 27kDa) associated protein 1 [ Homo sapiens ] |
| Official Symbol | HSPBAP1 |
| Synonyms | HSPBAP1; HSPB (heat shock 27kDa) associated protein 1; HSPB (heat shock 27kD) associated protein 1; HSPB1-associated protein 1; FLJ22623; PASS1; 27 kDa heat shock protein-associated protein 1; protein associating with small stress protein PASS1; FLJ39386; |
| Gene ID | 79663 |
| mRNA Refseq | NM_024610 |
| Protein Refseq | NP_078886 |
| MIM | 608263 |
| UniProt ID | Q96EW2 |
| ◆ Recombinant Proteins | ||
| HSPBAP1-3971HF | Recombinant Full Length Human HSPBAP1 Protein, GST-tagged | +Inquiry |
| HSPBAP1-3886H | Recombinant Human HSPBAP1 protein, His-tagged | +Inquiry |
| HSPBAP1-4367M | Recombinant Mouse HSPBAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hspbap1-3459M | Recombinant Mouse Hspbap1 Protein, Myc/DDK-tagged | +Inquiry |
| HSPBAP1-2610R | Recombinant Rat HSPBAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPBAP1-5343HCL | Recombinant Human HSPBAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPBAP1 Products
Required fields are marked with *
My Review for All HSPBAP1 Products
Required fields are marked with *
