Recombinant Human HSPBAP1 protein, His-tagged

Cat.No. : HSPBAP1-3886H
Product Overview : Recombinant Human HSPBAP1 protein(273-451 aa), fused to His tag, was expressed in E. coli.
Availability September 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 273-451 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : IELEEDHLARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASN
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HSPBAP1 HSPB (heat shock 27kDa) associated protein 1 [ Homo sapiens ]
Official Symbol HSPBAP1
Synonyms HSPBAP1; HSPB (heat shock 27kDa) associated protein 1; HSPB (heat shock 27kD) associated protein 1; HSPB1-associated protein 1; FLJ22623; PASS1; 27 kDa heat shock protein-associated protein 1; protein associating with small stress protein PASS1; FLJ39386;
Gene ID 79663
mRNA Refseq NM_024610
Protein Refseq NP_078886
MIM 608263
UniProt ID Q96EW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPBAP1 Products

Required fields are marked with *

My Review for All HSPBAP1 Products

Required fields are marked with *

0
cart-icon