Recombinant Human HSPE1 Protein
Cat.No. : | HSPE1-042H |
Product Overview : | Recombinant human HSPE1 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 102 |
Description : | This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3. |
Form : | Solution |
Molecular Mass : | 10 kDa |
AA Sequence : | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
Purity : | > 98% |
Applications : | WB |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris (pH 8). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | HSPE1 heat shock protein family E (Hsp10) member 1 [ Homo sapiens (human) ] |
Official Symbol | HSPE1 |
Synonyms | HSPE1; heat shock protein family E (Hsp10) member 1; EPF; CPN10; GROES; HSP10; 10 kDa heat shock protein, mitochondrial; Names; 10 kDa chaperonin; chaperonin 10; early-pregnancy factor; epididymis secretory sperm binding protein; heat shock 10kD protein 1 (chaperonin 10); heat shock 10kDa protein 1 |
Gene ID | 3336 |
mRNA Refseq | NM_002157 |
Protein Refseq | NP_002148 |
MIM | 600141 |
UniProt ID | P61604 |
◆ Recombinant Proteins | ||
HSPE1-5198H | Recombinant Human HSPE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSPE1-5653HF | Recombinant Full Length Human HSPE1 Protein, GST-tagged | +Inquiry |
HSPE1-4855H | Recombinant Human Heat Shock 10kDa Protein 1 (Chaperonin 10), GST-tagged | +Inquiry |
HSPE1-9075Z | Recombinant Zebrafish HSPE1 | +Inquiry |
HSPE1-042H | Recombinant Human HSPE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPE1-5339HCL | Recombinant Human HSPE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPE1 Products
Required fields are marked with *
My Review for All HSPE1 Products
Required fields are marked with *
0
Inquiry Basket