Recombinant Human HSPE1 Protein

• Cat.No.: HSPE1-042H
• Product Overview: Recombinant human HSPE1 protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 102
• Description: This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.
• Form: Solution
• Molecular Mass: 10 kDa
• AA Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
• Purity: > 98%
• Applications: WB
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Concentration: 1 mg/mL
• Storage Buffer: Tris (pH 8). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: HSPE1 heat shock protein family E (Hsp10) member 1 [ Homo sapiens (human) ]
• Official Symbol: HSPE1
• Synonyms: HSPE1; heat shock protein family E (Hsp10) member 1; EPF; CPN10; GROES; HSP10; 10 kDa heat shock protein, mitochondrial; Names; 10 kDa chaperonin; chaperonin 10; early-pregnancy factor; epididymis secretory sperm binding protein; heat shock 10kD protein 1 (chaperonin 10); heat shock 10kDa protein 1
• Gene ID: 3336
• mRNA Refseq: NM_002157
• Protein Refseq: NP_002148
• MIM: 600141
• UniProt ID: P61604