Recombinant Human HSPE1 Protein

Cat.No. : HSPE1-042H
Product Overview : Recombinant human HSPE1 protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 102
Description : This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.
Form : Solution
Molecular Mass : 10 kDa
AA Sequence : MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Purity : > 98%
Applications : WB
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : 4°C
Concentration : 1 mg/mL
Storage Buffer : Tris (pH 8). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name HSPE1 heat shock protein family E (Hsp10) member 1 [ Homo sapiens (human) ]
Official Symbol HSPE1
Synonyms HSPE1; heat shock protein family E (Hsp10) member 1; EPF; CPN10; GROES; HSP10; 10 kDa heat shock protein, mitochondrial; Names; 10 kDa chaperonin; chaperonin 10; early-pregnancy factor; epididymis secretory sperm binding protein; heat shock 10kD protein 1 (chaperonin 10); heat shock 10kDa protein 1
Gene ID 3336
mRNA Refseq NM_002157
Protein Refseq NP_002148
MIM 600141
UniProt ID P61604

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPE1 Products

Required fields are marked with *

My Review for All HSPE1 Products

Required fields are marked with *

0
cart-icon