Recombinant Human HSPE1 Protein, GST-tagged

Cat.No. : HSPE1-5263H
Product Overview : Human HSPE1 full-length ORF ( AAH23518, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. [provided by RefSeq
Molecular Mass : 36.96 kDa
AA Sequence : MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSPE1 heat shock 10kDa protein 1 (chaperonin 10) [ Homo sapiens ]
Official Symbol HSPE1
Synonyms HSPE1; heat shock 10kDa protein 1 (chaperonin 10); heat shock 10kD protein 1 (chaperonin 10); 10 kDa heat shock protein, mitochondrial; CPN10; GROES; chaperonin 10; 10 kDa chaperonin; early-pregnancy factor; EPF; HSP10;
Gene ID 3336
mRNA Refseq NM_002157
Protein Refseq NP_002148
MIM 600141
UniProt ID P61604

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPE1 Products

Required fields are marked with *

My Review for All HSPE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon