"HTR1A" Related Products

Expand
Expand
Expand

Recombinant Human HTR1A protein, GST-tagged

Cat.No.: HTR1A-26H
Product Overview: Recombinant Human HTR1A(1 a.a. - 422 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of this gene in mice results in behavior consistent with an increased anxiety and stress response. Mutation in the promoter of this gene has been associated with menstrual cycle-dependent periodic fevers.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 72.5 kDa
AA Sequence: MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLI GSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTP RRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFR IRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC HMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCRQ
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: HTR1A 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [ Homo sapiens ]
Official Symbol: HTR1A
Synonyms: HTR1A; 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1A , ADRB2RL1, ADRBRL1; 5-hydroxytryptamine receptor 1A; 5 HT1A; 5-HT1a receptor; serotonin receptor 1A; G protein coupled receptor; guanine nucleotide-binding regulatory protein-coupled receptor; G-21; 5HT1a; 5-HT1A; 5-HT-1A; ADRBRL1; ADRB2RL1;
Gene ID: 3350
mRNA Refseq: NM_000524
Protein Refseq: NP_000515
MIM: 109760
UniProt ID: P08908
Chromosome Location: 5q11.2-q13
Pathway: Amine ligand-binding receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Monoamine GPCRs, organism-specific biosystem;
Function: G-protein coupled receptor activity; drug binding; receptor activity; serotonin binding; serotonin receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.