Recombinant Human HTR1F protein(211-280 aa), His-tagged

• Cat.No.: HTR1F-15H
• Product Overview: Recombinant Human HTR1F protein(211-280 aa)(P30939), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 211-280 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR

Gene Information

• Gene Name: HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR1F
• Synonyms: HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F
• Gene ID: 3355
• mRNA Refseq: NM_000866
• Protein Refseq: NP_000857
• MIM: 182134
• UniProt ID: P30939