Recombinant Human HTR1F protein(211-280 aa), His-tagged
Cat.No. : | HTR1F-15H |
Product Overview : | Recombinant Human HTR1F protein(211-280 aa)(P30939), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 211-280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR |
Gene Name | HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR1F |
Synonyms | HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F |
Gene ID | 3355 |
mRNA Refseq | NM_000866 |
Protein Refseq | NP_000857 |
MIM | 182134 |
UniProt ID | P30939 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR1F Products
Required fields are marked with *
My Review for All HTR1F Products
Required fields are marked with *