Recombinant Human HTR1F protein(211-280 aa), His-tagged

Cat.No. : HTR1F-15H
Product Overview : Recombinant Human HTR1F protein(211-280 aa)(P30939), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 211-280 aa
Form : 0.15 M Phosphate buffered saline
Storage : Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR
Gene Name HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ]
Official Symbol HTR1F
Synonyms HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F
Gene ID 3355
mRNA Refseq NM_000866
Protein Refseq NP_000857
MIM 182134
UniProt ID P30939

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR1F Products

Required fields are marked with *

My Review for All HTR1F Products

Required fields are marked with *

0
cart-icon