Recombinant Human HTR1F Protein, GST-tagged
Cat.No. : | HTR1F-5245H |
Product Overview : | Human HTR1F partial ORF ( NP_000857, 203 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HTR1F (5-Hydroxytryptamine Receptor 1F) is a Protein Coding gene. Diseases associated with HTR1F include Migraine With Or Without Aura 1. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1E. |
Molecular Mass : | 34.21 kDa |
AA Sequence : | KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR1F |
Synonyms | HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F; |
Gene ID | 3355 |
mRNA Refseq | NM_000866 |
Protein Refseq | NP_000857 |
MIM | 182134 |
UniProt ID | P30939 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR1F Products
Required fields are marked with *
My Review for All HTR1F Products
Required fields are marked with *
0
Inquiry Basket