Recombinant Human HTR1F Protein, GST-tagged
| Cat.No. : | HTR1F-5245H |
| Product Overview : | Human HTR1F partial ORF ( NP_000857, 203 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HTR1F (5-Hydroxytryptamine Receptor 1F) is a Protein Coding gene. Diseases associated with HTR1F include Migraine With Or Without Aura 1. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1E. |
| Molecular Mass : | 34.21 kDa |
| AA Sequence : | KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ] |
| Official Symbol | HTR1F |
| Synonyms | HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F; |
| Gene ID | 3355 |
| mRNA Refseq | NM_000866 |
| Protein Refseq | NP_000857 |
| MIM | 182134 |
| UniProt ID | P30939 |
| ◆ Recombinant Proteins | ||
| HTR1F-2721H | Recombinant Human HTR1F Full Length Transmembrane protein (1-366 aa), His-SUMO-tagged | +Inquiry |
| HTR1F-2174R | Recombinant Rhesus monkey HTR1F Protein, His-tagged | +Inquiry |
| HTR1F-1995R | Recombinant Rhesus Macaque HTR1F Protein, His (Fc)-Avi-tagged | +Inquiry |
| HTR1F-15H | Recombinant Human HTR1F protein(211-280 aa), His-tagged | +Inquiry |
| HTR1F-7931M | Recombinant Mouse HTR1F Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR1F Products
Required fields are marked with *
My Review for All HTR1F Products
Required fields are marked with *
