Recombinant Human HTR1F Protein, GST-tagged

Cat.No. : HTR1F-5245H
Product Overview : Human HTR1F partial ORF ( NP_000857, 203 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HTR1F (5-Hydroxytryptamine Receptor 1F) is a Protein Coding gene. Diseases associated with HTR1F include Migraine With Or Without Aura 1. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1E.
Molecular Mass : 34.21 kDa
AA Sequence : KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ]
Official Symbol HTR1F
Synonyms HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F;
Gene ID 3355
mRNA Refseq NM_000866
Protein Refseq NP_000857
MIM 182134
UniProt ID P30939

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR1F Products

Required fields are marked with *

My Review for All HTR1F Products

Required fields are marked with *

0
cart-icon
0
compare icon