Recombinant Human HTT protein, His-tagged
| Cat.No. : | HTT-3873H |
| Product Overview : | Recombinant Human HTT protein(2845-3000 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2845-3000 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HTT huntingtin [ Homo sapiens ] |
| Official Symbol | HTT |
| Synonyms | HTT; huntingtin; HD, huntingtin (Huntington disease); IT15; huntington disease protein; HD; |
| Gene ID | 3064 |
| mRNA Refseq | NM_002111 |
| Protein Refseq | NP_002102 |
| MIM | 613004 |
| UniProt ID | P42858 |
| ◆ Recombinant Proteins | ||
| HTT-8648Z | Recombinant Zebrafish HTT | +Inquiry |
| Htt-1597M | Recombinant Mouse Htt protein, His & GST-tagged | +Inquiry |
| Htt-1107M | Recombinant Mouse Htt Protein, MYC/DDK-tagged | +Inquiry |
| htt-3808D | Recombinant ZHD, GST-tagged | +Inquiry |
| HTT-1313H | Recombinant Human HTT protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HTT-204HKCL | Human HTT Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTT Products
Required fields are marked with *
My Review for All HTT Products
Required fields are marked with *
