Recombinant Human HYAL1
Cat.No. : | HYAL1-29415TH |
Product Overview : | Recombinant full length Human HYAL1 with proprietary tag; Predicted MWt 53.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 253 amino acids |
Description : | This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 53.900kDa inclusive of tags |
Tissue specificity : | Highly expressed in the liver, kidney and heart. Weakly expressed in lung, placenta and skeletal muscle. No expression detected in adult brain. Isoform 1 is expressed only in bladder and prostate cancer cells, G2/G3 bladder tumor tissues and lymph node sp |
Biological activity : | useful for Antibody Production and Protein Array |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW |
Sequence Similarities : | Belongs to the glycosyl hydrolase 56 family.Contains 1 EGF-like domain. |
Gene Name | HYAL1 hyaluronoglucosaminidase 1 [ Homo sapiens ] |
Official Symbol | HYAL1 |
Synonyms | HYAL1; hyaluronoglucosaminidase 1; hyaluronidase-1; FUS2; HYAL 1; LUCA1; NAT6; |
Gene ID | 3373 |
mRNA Refseq | NM_007312 |
Protein Refseq | NP_009296 |
MIM | 607071 |
Uniprot ID | Q12794 |
Chromosome Location | 3p21.3-p21.2 |
Pathway | Chondroitin sulfate degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Dermatan sulfate degradation, organism-specific biosystem; Dermatan sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem; |
Function | hyalurononglucosaminidase activity; hydrolase activity, acting on glycosyl bonds; |
◆ Recombinant Proteins | ||
HYAL1-7952M | Recombinant Mouse HYAL1 Protein | +Inquiry |
HYAL1-13H | Active Recombinant Human HYAL1 protein, His-tagged | +Inquiry |
HYAL1-2630R | Recombinant Rat HYAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HYAL1-29413TH | Recombinant Human HYAL1 | +Inquiry |
HYAL1-3467H | Recombinant Human HYAL1 Protein (Phe22-Trp435), His tagged | +Inquiry |
◆ Native Proteins | ||
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HYAL1-5324HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
HYAL1-5325HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYAL1 Products
Required fields are marked with *
My Review for All HYAL1 Products
Required fields are marked with *
0
Inquiry Basket