Recombinant Human HYAL1 protein, His-tagged
Cat.No. : | HYAL1-12H |
Product Overview : | Recombinant Human HYAL1(Phe22-Trp435) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-435 a.a. |
Description : | Hyaluronidase-1 (HYAL1) is a secreted lysosomal hyaluronidase that belongs to the glycosyl hydrolase 56 family. HYAL1 contains one EGF-like domain and is highly expressed in the liver, kidney, and heart, but it is weakly expressed in the lung, placenta, and skeletal muscle. HYAL1 is thought to be involved in cell proliferation, migration, and differentiation. It may play a role in promoting tumor progression and blocking the TGFB1-enhanced cell growth. Mutations in HYAL1 are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10%Glycerol, pH7.5. |
AA Sequence : | FRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYYT PTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRS RALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPN YTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNL PVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGP FILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQ MAVEFKCRCYPGWQAPWCERKSMWVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | HYAL1 hyaluronoglucosaminidase 1 [ Homo sapiens ] |
Official Symbol | HYAL1 |
Synonyms | HYAL1; hyaluronoglucosaminidase 1; hyaluronidase-1; FUS2; HYAL 1; LUCA1; NAT6; luCa-1; hyaluronidase 1; plasma hyaluronidase; tumor suppressor LUCA-1; lung carcinoma protein 1; hyaluronoglucosaminidase-1; HYAL-1; MGC45987; |
Gene ID | 3373 |
mRNA Refseq | NM_007312 |
Protein Refseq | NP_009296 |
MIM | 607071 |
UniProt ID | Q12794 |
◆ Recombinant Proteins | ||
HYAL1-12H | Recombinant Human HYAL1 protein, His-tagged | +Inquiry |
HYAL1-1595H | Recombinant Human HYAL1 protein, His-tagged | +Inquiry |
HYAL1-11HFL | Active Recombinant Full Length Human HYAL1 Protein, C-6×His tagged | +Inquiry |
HYAL1-5761H | Recombinant Human HYAL1 protein, His-tagged | +Inquiry |
HYAL1-2630R | Recombinant Rat HYAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HYAL1-5324HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
HYAL1-5325HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYAL1 Products
Required fields are marked with *
My Review for All HYAL1 Products
Required fields are marked with *