Recombinant Human IAPP Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : IAPP-153H
Product Overview : IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity.
Molecular Mass : 9.81 kDa
AA Sequence : MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IAPP islet amyloid polypeptide [ Homo sapiens (human) ]
Official Symbol IAPP
Synonyms IAPP; islet amyloid polypeptide; DAP; IAP; islet amyloid polypeptide; Islet amyloid polypeptide (diabetes-associated peptide; amylin); amylin; diabetes-associated peptide; insulinoma amyloid peptide
Gene ID 3375
mRNA Refseq NM_000415
Protein Refseq NP_000406
MIM 147940
UniProt ID P10997

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IAPP Products

Required fields are marked with *

My Review for All IAPP Products

Required fields are marked with *

0
cart-icon