Recombinant Human IAPP Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | IAPP-153H |
Product Overview : | IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. |
Molecular Mass : | 9.81 kDa |
AA Sequence : | MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IAPP islet amyloid polypeptide [ Homo sapiens (human) ] |
Official Symbol | IAPP |
Synonyms | IAPP; islet amyloid polypeptide; DAP; IAP; islet amyloid polypeptide; Islet amyloid polypeptide (diabetes-associated peptide; amylin); amylin; diabetes-associated peptide; insulinoma amyloid peptide |
Gene ID | 3375 |
mRNA Refseq | NM_000415 |
Protein Refseq | NP_000406 |
MIM | 147940 |
UniProt ID | P10997 |
◆ Recombinant Proteins | ||
IAPP-001H | Human Amylin, Amide | +Inquiry |
IAPP-185H | Recombinant Human Islet Amyloid Polypeptide | +Inquiry |
IAPP-2553H | Recombinant Human IAPP Protein (34-70 aa), His-tagged | +Inquiry |
IAPP-2632R | Recombinant Rat IAPP Protein, His (Fc)-Avi-tagged | +Inquiry |
IAPP-6144HFL | Recombinant Full Length Human IAPP protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IAPP-5319HCL | Recombinant Human IAPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IAPP Products
Required fields are marked with *
My Review for All IAPP Products
Required fields are marked with *