Recombinant Human IBSP Protein, His-SUMO-tagged
| Cat.No. : | IBSP-1251H |
| Product Overview : | Recombinant Human IBSP Protein (129-281aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 129-281 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 32.4 kDa |
| AA Sequence : | AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNG EEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGA NEYDNGYEIYESE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | IBSP integrin-binding sialoprotein [ Homo sapiens ] |
| Official Symbol | IBSP |
| Synonyms | IBSP; integrin-binding sialoprotein; bone sialoprotein 2; bone sialoprotein; bone sialoprotein II; BSP; BSP II; SP II; cell-binding sialoprotein; BNSP; SP-II; BSP-II |
| Gene ID | 3381 |
| mRNA Refseq | NM_004967 |
| Protein Refseq | NP_004958 |
| MIM | 147563 |
| UniProt ID | P21815 |
| ◆ Recombinant Proteins | ||
| IBSP-377H | Recombinant Human IBSP Protein, His&SUMO-tagged | +Inquiry |
| IBSP-12HFL | Active Recombinant Full Length Human IBSP Protein, His-tagged | +Inquiry |
| IBSP-376H | Recombinant Human IBSP Protein, His-tagged | +Inquiry |
| IBSP-717H | Recombinant Human IBSP Protein, DDK/His-tagged | +Inquiry |
| IBSP-718H | Recombinant Human IBSP Protein, DDK/His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IBSP Products
Required fields are marked with *
My Review for All IBSP Products
Required fields are marked with *




