Recombinant Human IDH3A

• Cat.No.: IDH3A-28925TH
• Product Overview: Recombinant full length Human IDH3A with N-terminal proprietary tag. Mol Wt 66 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 366 amino acids
• Description: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.
• Molecular Weight: 66.000kDa
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGD GIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMI PSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI VDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHK ANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGL FDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR RVKDLD
• Sequence Similarities: Belongs to the isocitrate and isopropylmalate dehydrogenases family.

Gene Information

• Gene Name: IDH3A isocitrate dehydrogenase 3 (NAD+) alpha [ Homo sapiens ]
• Official Symbol: IDH3A
• Synonyms: IDH3A; isocitrate dehydrogenase 3 (NAD+) alpha; isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; H IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase [NAD] subunit alpha; mitochondrial; isocitric dehydrogenase; NA
• Gene ID: 3419
• mRNA Refseq: NM_005530
• Protein Refseq: NP_005521
• MIM: 601149
• Uniprot ID: P50213
• Chromosome Location: 15q25.1-q25.2
• Pathway: Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
• Function: NAD binding; isocitrate dehydrogenase (NAD+) activity; magnesium ion binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor