Recombinant Human IDH3A

Cat.No. : IDH3A-28925TH
Product Overview : Recombinant full length Human IDH3A with N-terminal proprietary tag. Mol Wt 66 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 366 amino acids
Description : Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.
Molecular Weight : 66.000kDa
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGD GIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMI PSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI VDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHK ANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGL FDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR RVKDLD
Sequence Similarities : Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Gene Name IDH3A isocitrate dehydrogenase 3 (NAD+) alpha [ Homo sapiens ]
Official Symbol IDH3A
Synonyms IDH3A; isocitrate dehydrogenase 3 (NAD+) alpha; isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; H IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase [NAD] subunit alpha; mitochondrial; isocitric dehydrogenase; NA
Gene ID 3419
mRNA Refseq NM_005530
Protein Refseq NP_005521
MIM 601149
Uniprot ID P50213
Chromosome Location 15q25.1-q25.2
Pathway Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
Function NAD binding; isocitrate dehydrogenase (NAD+) activity; magnesium ion binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IDH3A Products

Required fields are marked with *

My Review for All IDH3A Products

Required fields are marked with *

0
cart-icon