Recombinant Human IDH3B Protein (35-385 aa), GST-tagged

• Cat.No.: IDH3B-566H
• Product Overview: Recombinant Human IDH3B Protein (35-385 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 35-385 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 65.8 kDa
• AA Sequence: ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: IDH3B isocitrate dehydrogenase 3 (NAD+) beta [ Homo sapiens ]
• Official Symbol: IDH3B
• Synonyms: IDH3B; RP46; H-IDHB; MGC903; FLJ11043
• Gene ID: 3420
• mRNA Refseq: NM_006899
• Protein Refseq: NP_008830
• MIM: 604526
• UniProt ID: O43837