Recombinant Human IDUA Protein (28-653 aa), His-tagged
Cat.No. : | IDUA-569H |
Product Overview : | Recombinant Human IDUA Protein (28-653 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-653 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 73.9 kDa |
AA Sequence : | APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | IDUA iduronidase, alpha-L- [ Homo sapiens ] |
Official Symbol | IDUA |
Synonyms | IDUA; MPS1; IDA; |
Gene ID | 3425 |
mRNA Refseq | NM_000203 |
Protein Refseq | NP_000194 |
MIM | 252800 |
UniProt ID | P35475 |
◆ Recombinant Proteins | ||
Idua-1215M | Recombinant Mouse Idua Protein, MYC/DDK-tagged | +Inquiry |
IDUA-27H | Active Recombinant Human IDUA, His-tagged | +Inquiry |
IDUA-995H | Recombinant Human IDUA Protein, MYC/DDK-tagged | +Inquiry |
Idua-3369M | Recombinant Mouse Idua, His-tagged | +Inquiry |
IDUA-1579H | Recombinant Human IDUA protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDUA Products
Required fields are marked with *
My Review for All IDUA Products
Required fields are marked with *
0
Inquiry Basket