Recombinant Human IFI35 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IFI35-5254H |
Product Overview : | IFI35 MS Standard C13 and N15-labeled recombinant protein (NP_005524) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Not yet known. |
Molecular Mass : | 31.7 kDa |
AA Sequence : | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IFI35 interferon-induced protein 35 [ Homo sapiens (human) ] |
Official Symbol | IFI35 |
Synonyms | IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35; IFP 35; ifi-35; FLJ21753; |
Gene ID | 3430 |
mRNA Refseq | NM_005533 |
Protein Refseq | NP_005524 |
MIM | 600735 |
UniProt ID | P80217 |
◆ Recombinant Proteins | ||
IFI35-2199R | Recombinant Rhesus monkey IFI35 Protein, His-tagged | +Inquiry |
IFI35-2010HFL | Recombinant Full Length Human IFI35 Protein, C-Flag-tagged | +Inquiry |
IFI35-2020R | Recombinant Rhesus Macaque IFI35 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFI35-3371H | Recombinant Human IFI35 Protein (Ser2-Gly286), N-His tagged | +Inquiry |
IFI35-26948TH | Recombinant Human IFI35 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI35-5293HCL | Recombinant Human IFI35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI35 Products
Required fields are marked with *
My Review for All IFI35 Products
Required fields are marked with *
0
Inquiry Basket