Recombinant Human IFI35 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | IFI35-5254H |
| Product Overview : | IFI35 MS Standard C13 and N15-labeled recombinant protein (NP_005524) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Not yet known. |
| Molecular Mass : | 31.7 kDa |
| AA Sequence : | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | IFI35 interferon-induced protein 35 [ Homo sapiens (human) ] |
| Official Symbol | IFI35 |
| Synonyms | IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35; IFP 35; ifi-35; FLJ21753; |
| Gene ID | 3430 |
| mRNA Refseq | NM_005533 |
| Protein Refseq | NP_005524 |
| MIM | 600735 |
| UniProt ID | P80217 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI35 Products
Required fields are marked with *
My Review for All IFI35 Products
Required fields are marked with *
